Lineage for d5oclf_ (5ocl F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356783Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)
  8. 2356858Domain d5oclf_: 5ocl F: [337254]
    automated match to d2p49b_

Details for d5oclf_

PDB Entry: 5ocl (more details), 2.2 Å

PDB Description: nanobody-anti-vglut nanobody complex
PDB Compounds: (F:) anti-llama nanobody

SCOPe Domain Sequences for d5oclf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oclf_ b.1.1.1 (F:) automated matches {Vicugna pacos [TaxId: 30538]}
gpsqgqlvesggglvqaggslrlscaasgiifrelgidwyrqapgkqrelvasiasagmt
nyadsvkgrftisrdnakntvylqmnslkpedtavyychtlprfshlwgqgtrvtvss

SCOPe Domain Coordinates for d5oclf_:

Click to download the PDB-style file with coordinates for d5oclf_.
(The format of our PDB-style files is described here.)

Timeline for d5oclf_: