SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5thpj_ (5thp J:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208774Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2208775Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2208776Family d.169.1.1: C-type lectin domain [56437] (29 protein domains)
    Pfam PF00059
  6. 2209209Protein automated matches [190329] (9 species)
    not a true protein
  7. 2209253Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (3 PDB entries)
  8. 2293941Domain d5thpj_: 5thp J: [337242]
    Other proteins in same PDB: d5thpc_, d5thpf_, d5thpi_, d5thpl_, d5thpo_, d5thpr_
    automated match to d1v4la_
    complexed with cl, gol, mg, na, so4

Details for d5thpj_

PDB Entry: 5thp (more details), 3.01 Å

PDB Description: rhodocetin in complex with the integrin alpha2-a domain
PDB Compounds: (J:) Snaclec rhodocetin subunit gamma

SCOPe Domain Sequences for d5thpj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thpj_ d.169.1.1 (J:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
aknpfvckfps

SCOPe Domain Coordinates for d5thpj_:

Click to download the PDB-style file with coordinates for d5thpj_.
(The format of our PDB-style files is described here.)

Timeline for d5thpj_:

  • d5thpj_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03