| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein automated matches [190224] (17 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [260543] (10 PDB entries) |
| Domain d5mx2a_: 5mx2 A: [337229] Other proteins in same PDB: d5mx2b_, d5mx2c_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2x_, d5mx2z_ automated match to d2axta1 complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd |
PDB Entry: 5mx2 (more details), 2.2 Å
SCOPe Domain Sequences for d5mx2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mx2a_ f.26.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
nlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgsl
lygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrqw
elsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaehn
ilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetynivaa
hgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidakg
nvintwadiinranlgmevmhernahnfpldla
Timeline for d5mx2a_: