SCOP 1.59: Domain d1tgoa1: 1tgo A:1-347

Lineage for d1tgoa1 (1tgo A:1-347)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)

6. Protein Exonuclease domain of family B (archaeal and phage) DNA polymerases [53125] (6 species)

7. Species Archaeon Thermococcus gorgonarius [TaxId:71997] [53128] (1 PDB entry)

8. Domain d1tgoa1: 1tgo A:1-347 [33721]
   Other proteins in same PDB: d1tgoa2

Details for d1tgoa1

PDB Entry: 1tgo, 2.5 Å

PDB Description: thermostable b type dna polymerase from thermococcus gorgonarius

SCOP Domain Sequences for d1tgoa1:

Sequence; same for both SEQRES and ATOM records:

>d1tgoa1 c.55.3.5 (A:1-347) Exonuclease domain of family B (archaeal and phage) DNA polymerases {Archaeon Thermococcus gorgonarius}
mildtdyitedgkpvirifkkengefkidydrnfepyiyallkddsaiedvkkitaerhg
ttvrvvraekvkkkflgrpievwklyfthpqdvpairdkikehpavvdiyeydipfakry
lidkglipmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknidlpy
vdvvstekemikrflkvvkekdpdvlityngdnfdfaylkkrseklgvkfilgregsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeaifgqpkekvyaeeiaqawe
tgeglervarysmedakvtyelgkeffpmeaqlsrlvgqslwdvsrs

Timeline for d1tgoa1:

• d1tgoa1 first appeared (with stable ids) in SCOP 1.55
  
• d1tgoa1 appears in SCOP 1.57
  
• d1tgoa1 appears in SCOP 1.61
  
• d1tgoa1 appears in the current release, SCOPe 2.08