Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins) contains three domains of this fold; "Helical backbone" holds domains 2 and 3 both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3 automatically mapped to Pfam PF00148 |
Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species) both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3 |
Species Clostridium pasteurianum [TaxId:1501] [81395] (5 PDB entries) |
Domain d5vpwd_: 5vpw D: [337140] Other proteins in same PDB: d5vpwa_, d5vpwc_ automated match to d1miob_ complexed with clf, fe2, hca, ics |
PDB Entry: 5vpw (more details), 1.85 Å
SCOPe Domain Sequences for d5vpwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vpwd_ c.92.2.3 (D:) Nitrogenase iron-molybdenum protein, beta chain {Clostridium pasteurianum [TaxId: 1501]} mldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhf kepamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyis qmedagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvg padmreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltls lgsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqli dlmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlae agiegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghy ynpkvgykgairlveeitnvildkierecteedfevvr
Timeline for d5vpwd_: