Lineage for d5xcya_ (5xcy A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458768Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2458769Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2458770Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins)
    Pfam PF01341
  6. 2458814Protein automated matches [191253] (6 species)
    not a true protein
  7. 2458815Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [337129] (2 PDB entries)
  8. 2458816Domain d5xcya_: 5xcy A: [337134]
    automated match to d1gz1a_

Details for d5xcya_

PDB Entry: 5xcy (more details), 1.2 Å

PDB Description: structure of the cellobiohydrolase cel6a from phanerochaete chrysosporium at 1.2 angstrom
PDB Compounds: (A:) glucanase

SCOPe Domain Sequences for d5xcya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xcya_ c.6.1.1 (A:) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
sannpwtgfqiflspyyanevaaaakqitdptlsskaasvaniptftwldsvakipdlgt
ylasasalgkstgtkqlvqiviydlpdrdcaakasngefsianngqanyenyidqivaqi
qqfpdvrvvaviepdslanlvtnlnvqkcanakttylacvnyaltnlakvgvymymdagh
agwlgwpanlspaaqlftqvwqnagkspfikglatnvanynalqaaspdpitqgnpnyde
ihyinalapllqqagwdatfivdqgrsgvqnirqqwgdwcnikgagfgtrpttntgsqfi
dsivwvkpggecdgtsnsssprydstcslpdaaqpapeagtwfqayfqtlvsaanppl

SCOPe Domain Coordinates for d5xcya_:

Click to download the PDB-style file with coordinates for d5xcya_.
(The format of our PDB-style files is described here.)

Timeline for d5xcya_: