Lineage for d5o2ta_ (5o2t A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111131Protein automated matches [190047] (28 species)
    not a true protein
  7. 2111209Species Human (Homo sapiens) [TaxId:9606] [186768] (168 PDB entries)
  8. 2293765Domain d5o2ta_: 5o2t A: [337066]
    Other proteins in same PDB: d5o2tb1, d5o2tb2
    automated match to d1r2qa_
    complexed with gsp, mg, so4

Details for d5o2ta_

PDB Entry: 5o2t (more details), 2.19 Å

PDB Description: human kras in complex with darpin k27
PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d5o2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o2ta_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreir

SCOPe Domain Coordinates for d5o2ta_:

Click to download the PDB-style file with coordinates for d5o2ta_.
(The format of our PDB-style files is described here.)

Timeline for d5o2ta_:

  • d5o2ta_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27