SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5o2ta_ (5o2t A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111131Protein automated matches [190047] (28 species)
    not a true protein
  7. 2111209Species Human (Homo sapiens) [TaxId:9606] [186768] (162 PDB entries)
  8. 2293765Domain d5o2ta_: 5o2t A: [337066]
    Other proteins in same PDB: d5o2tb1, d5o2tb2
    automated match to d1r2qa_
    complexed with gsp, mg, so4

Details for d5o2ta_

PDB Entry: 5o2t (more details), 2.19 Å

PDB Description: human kras in complex with darpin k27
PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d5o2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o2ta_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreir

SCOPe Domain Coordinates for d5o2ta_:

Click to download the PDB-style file with coordinates for d5o2ta_.
(The format of our PDB-style files is described here.)

Timeline for d5o2ta_:

  • d5o2ta_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27