Lineage for d5v5kh_ (5v5k H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317166Species Archaeoglobus fulgidus [TaxId:2234] [186755] (3 PDB entries)
  8. 2317197Domain d5v5kh_: 5v5k H: [336851]
    automated match to d1s3qj_
    mutant

Details for d5v5kh_

PDB Entry: 5v5k (more details), 3.08 Å

PDB Description: crystal structure of ferritin e65r mutant from hyperthermophilic archaeon archaeoglobus fulgidus
PDB Compounds: (H:) Ferritin

SCOPe Domain Sequences for d5v5kh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v5kh_ a.25.1.0 (H:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
vsrrggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
qwyvaeqveeeasaldiveklrligedkrallfldkelslrq

SCOPe Domain Coordinates for d5v5kh_:

Click to download the PDB-style file with coordinates for d5v5kh_.
(The format of our PDB-style files is described here.)

Timeline for d5v5kh_: