Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
Protein Retroviral integrase, catalytic domain [53108] (4 species) |
Species Simian immunodeficiency virus [TaxId:11723] [53111] (3 PDB entries) |
Domain d1c6va_: 1c6v A: [33672] Other proteins in same PDB: d1c6vx_ mutant |
PDB Entry: 1c6v (more details), 3 Å
SCOPe Domain Sequences for d1c6va_:
Sequence, based on SEQRES records: (download)
>d1c6va_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Simian immunodeficiency virus [TaxId: 11723]} nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh tdnganfasqevkmvawwagiehtfgvpynpqsqgvveamnhhlknqidrireqansvet ivlmavhcmnhkrrggigdmtpaerlinmitteqeiqfq
>d1c6va_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Simian immunodeficiency virus [TaxId: 11723]} nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh tdnganfasqevkmvawwagiehtfgeamnhhlknqidrireqansvetivlmavhcmnh krrggigdmtpaerlinmitteqeiqfq
Timeline for d1c6va_:
View in 3D Domains from other chains: (mouse over for more information) d1c6vb_, d1c6vc_, d1c6vd_, d1c6vx_ |