Lineage for d5oaza_ (5oaz A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.2: SH3-domain [50044] (2 families) 
Family b.34.2.1: SH3-domain [50045] (40 proteins) Protein automated matches [190043] (8 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187799] (39 PDB entries) 
Domain d5oaza_: 5oaz A: [336624]
automated match to d3eg2a_
complexed with peg
Details for d5oaza_
PDB Entry: 5oaz (more details), 1.03 Å
PDB Description: crystal structure of the abl-sh3 domain at ph 7.5
PDB Compounds: (A:) Tyrosine-protein kinase ABL1SCOPe Domain Sequences for d5oaza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oaza_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn
SCOPe Domain Coordinates for d5oaza_:
Click to download the PDB-style file with coordinates for d5oaza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5oaza_:
View in 3D
