Lineage for d5kpfb1 (5kpf B:-4-103)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304491Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2304495Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (90 PDB entries)
    Uniprot P00044
  8. 2304521Domain d5kpfb1: 5kpf B:-4-103 [336613]
    Other proteins in same PDB: d5kpfa2, d5kpfb2
    automated match to d1s6vb_
    complexed with 6vj, hec, no3

Details for d5kpfb1

PDB Entry: 5kpf (more details), 1.7 Å

PDB Description: crystal structure of cytochrome c - phenyl-trisulfonatocalix[4]arene complex
PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d5kpfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kpfb1 a.3.1.1 (B:-4-103) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
vlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

SCOPe Domain Coordinates for d5kpfb1:

Click to download the PDB-style file with coordinates for d5kpfb1.
(The format of our PDB-style files is described here.)

Timeline for d5kpfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5kpfb2