SCOPe 2.07: Domain d5ipdb_: 5ipd B:

Lineage for d5ipdb_ (5ipd B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
   Pfam PF01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein Histidine triad nucleotide-binding protein (HINT) [54199] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [224916] (19 PDB entries)

8. Domain d5ipdb_: 5ipd B: [336446]
   automated match to d3tw2a_
   complexed with 6cg

Details for d5ipdb_

PDB Entry: 5ipd, 1.75 Å

PDB Description: human histidine triad nucleotide binding protein 1 (hhint1) nucleoside thiophosphoramidate covalent intermediate complex

PDB Compounds: (B:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d5ipdb_:

Sequence; same for both SEQRES and ATOM records:

>d5ipdb_ d.13.1.1 (B:) Histidine triad nucleotide-binding protein (HINT) {Human (Homo sapiens) [TaxId: 9606]}
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

Timeline for d5ipdb_:

• d5ipdb_ first appeared in SCOPe 2.06
  
• d5ipdb_ appears in the current release, SCOPe 2.08