Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) |
Family c.55.3.1: Ribonuclease H [53099] (3 proteins) |
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (50 PDB entries) |
Domain d1fkpa1: 1fkp A:430-542 [33617] Other proteins in same PDB: d1fkpa2, d1fkpb1 |
PDB Entry: 1fkp (more details), 2.9 Å
SCOP Domain Sequences for d1fkpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fkpa1 c.55.3.1 (A:430-542) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1} ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgi
Timeline for d1fkpa1: