Lineage for d1qe1a1 (1qe1 A:430-556)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397315Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 397627Superfamily c.55.3: Ribonuclease H-like [53098] (9 families) (S)
    consists of one domain of this fold
  5. 397628Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 397638Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 397639Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (73 PDB entries)
  8. 397692Domain d1qe1a1: 1qe1 A:430-556 [33593]
    Other proteins in same PDB: d1qe1a2, d1qe1b_
    mutant

Details for d1qe1a1

PDB Entry: 1qe1 (more details), 2.85 Å

PDB Description: crystal structure of 3tc-resistant m184i mutant of hiv-1 reverse transcriptase

SCOP Domain Sequences for d1qe1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qe1a1 c.55.3.1 (A:430-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagi

SCOP Domain Coordinates for d1qe1a1:

Click to download the PDB-style file with coordinates for d1qe1a1.
(The format of our PDB-style files is described here.)

Timeline for d1qe1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qe1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1qe1b_