SCOP 1.59: Domain d1hrhb1: 1hrh B:432-554

Lineage for d1hrhb1 (1hrh B:432-554)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (57 PDB entries)

8. Domain d1hrhb1: 1hrh B:432-554 [33578]

Details for d1hrhb1

PDB Entry: 1hrh, 2.4 Å

PDB Description: crystal structure of the ribonuclease h domain of hiv-1 reverse transcriptase

SCOP Domain Sequences for d1hrhb1:

Sequence, based on SEQRES records:

>d1hrhb1 c.55.3.1 (B:432-554) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
epivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgl
evnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvdkl
vsa

Sequence, based on observed residues (ATOM records):

>d1hrhb1 c.55.3.1 (B:432-554) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
epivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgl
evnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpgneqvdklvsa

Timeline for d1hrhb1:

• d1hrhb1 first appeared (with stable ids) in SCOP 1.55
  
• d1hrhb1 appears in SCOP 1.57
  
• d1hrhb1 appears in SCOP 1.61
  
• d1hrhb1 appears in the current release, SCOPe 2.08