Lineage for d1rbs__ (1rbs -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 72015Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 72016Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 72084Protein RNase H (RNase HI) [53100] (2 species)
  7. 72085Species Escherichia coli [TaxId:562] [53101] (22 PDB entries)
  8. 72095Domain d1rbs__: 1rbs - [33558]

Details for d1rbs__

PDB Entry: 1rbs (more details), 1.8 Å

PDB Description: structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability

SCOP Domain Sequences for d1rbs__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rbs__ c.55.3.1 (-) RNase H (RNase HI) {Escherichia coli}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
eacevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev

SCOP Domain Coordinates for d1rbs__:

Click to download the PDB-style file with coordinates for d1rbs__.
(The format of our PDB-style files is described here.)

Timeline for d1rbs__: