Lineage for d5t0ef_ (5t0e F:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645520Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)
  8. 2645590Domain d5t0ef_: 5t0e F: [335578]
    Other proteins in same PDB: d5t0ea_, d5t0ec_, d5t0ee_
    automated match to d4kdmb_
    complexed with gal, nag, sia; mutant

Details for d5t0ef_

PDB Entry: 5t0e (more details), 2.09 Å

PDB Description: crystal structure of h6 hemagglutinin g225d mutant from taiwan (2013) h6n1 influenza virus in complex with lsta
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5t0ef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t0ef_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqg

SCOPe Domain Coordinates for d5t0ef_:

Click to download the PDB-style file with coordinates for d5t0ef_.
(The format of our PDB-style files is described here.)

Timeline for d5t0ef_: