Lineage for d5v84c_ (5v84 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2320183Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 2321455Domain d5v84c_: 5v84 C: [335533]
    automated match to d4nyxa_
    complexed with 96v, so4

Details for d5v84c_

PDB Entry: 5v84 (more details), 2.7 Å

PDB Description: cecr2 in complex with cpd6 (6-allyl-n,2-dimethyl-7-oxo-n-(1-(1- phenylethyl)piperidin-4-yl)-6,7-dihydro-1h-pyrrolo[2,3-c]pyridine-4- carboxamide)
PDB Compounds: (C:) Cat eye syndrome critical region protein 2

SCOPe Domain Sequences for d5v84c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v84c_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dddftamykvldvvkahkdswpflepvdesyapnyyqiikapmdissmekklngglyctk
eefvndmktmfrncrkyngesseytkmsdnlercfhrammkh

SCOPe Domain Coordinates for d5v84c_:

Click to download the PDB-style file with coordinates for d5v84c_.
(The format of our PDB-style files is described here.)

Timeline for d5v84c_: