SCOP 1.63: Domain d1chma1: 1chm A:2-156

Lineage for d1chma1 (1chm A:2-156)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family)

5. Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)

6. Protein Creatinase [53094] (2 species)

7. Species Pseudomonas putida [TaxId:303] [53095] (1 PDB entry)

8. Domain d1chma1: 1chm A:2-156 [33545]
   Other proteins in same PDB: d1chma2, d1chmb2

Details for d1chma1

PDB Entry: 1chm, 1.9 Å

PDB Description: enzymatic mechanism of creatine amidinohydrolase as deduced from crystal structures

SCOP Domain Sequences for d1chma1:

Sequence; same for both SEQRES and ATOM records:

>d1chma1 c.55.2.1 (A:2-156) Creatinase {Pseudomonas putida}
qmpktlrirngdkvrstfsaqeyanrqarlrahlaaenidaaiftsyhninyysdflycs
fgrpyalvvteddvisisanidggqpwrrtvgtdnivytdwqrdnyfaaiqqalpkarri
giehdhlnlqnrdklaarypdaelvdvaaacmrmr

Timeline for d1chma1:

• d1chma1 first appeared (with stable ids) in SCOP 1.55
  
• d1chma1 appears in SCOP 1.61
  
• d1chma1 appears in SCOP 1.65
  
• d1chma1 appears in the current release, SCOPe 2.08