Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries) |
Domain d5nmle1: 5nml E:2-118 [335320] Other proteins in same PDB: d5nmla2, d5nmlb2, d5nmlc2, d5nmld2, d5nmle2, d5nmlf2, d5nmlg2, d5nmlh2, d5nmli2 automated match to d3ogog_ complexed with edo, hg |
PDB Entry: 5nml (more details), 2.5 Å
SCOPe Domain Sequences for d5nmle1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nmle1 b.1.1.1 (E:2-118) automated matches {Llama (Lama glama) [TaxId: 9844]} qvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyv dsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvs
Timeline for d5nmle1: