Lineage for d5mnja_ (5mnj A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546043Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2546210Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (24 PDB entries)
    Uniprot P62837
    E2-17 kDa 2
  8. 2546227Domain d5mnja_: 5mnj A: [334869]
    Other proteins in same PDB: d5mnjb_, d5mnjf_
    automated match to d2clwa_
    complexed with so4, zn

Details for d5mnja_

PDB Entry: 5mnj (more details), 2.16 Å

PDB Description: structure of mdm2-mdmx-ubch5b-ubiquitin complex
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d5mnja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mnja_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
alkrihkelndlardppaqcragpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsikldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d5mnja_:

Click to download the PDB-style file with coordinates for d5mnja_.
(The format of our PDB-style files is described here.)

Timeline for d5mnja_: