SCOPe 2.07: Domain d5o00a2: 5o00 A:93-229

Lineage for d5o00a2 (5o00 A:93-229)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226686] (9 PDB entries)

8. Domain d5o00a2: 5o00 A:93-229 [334600]
   Other proteins in same PDB: d5o00a1
   automated match to d4f0ca2
   complexed with gds, gol, nin, so4

Details for d5o00a2

PDB Entry: 5o00, 2.03 Å

PDB Description: ure2p5 from phanerochaete chrysosporium cocrystallized with 1-(s- glutathionyl)-2,4-dinitrobenzene.

PDB Compounds: (A:) Glutathione transferase Ure2p5

SCOPe Domain Sequences for d5o00a2:

Sequence; same for both SEQRES and ATOM records:

>d5o00a2 a.45.1.0 (A:93-229) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
vstfddkiimtqwlffqasgqgpyfgqagwflavappeernptiaeryqkeilrvfgvle
svlsqrqwlvadkltiadisfviwnatavnllvkgykgfdfekdfpsvhrwhtalitrpa
iaeslktkaeaiaqmnr

Timeline for d5o00a2:

• d5o00a2 first appeared in SCOPe 2.06
  
• d5o00a2 appears in the current release, SCOPe 2.08