Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries) |
Domain d1ngga2: 1ngg A:189-381 [33416] complexed with atp, mg; mutant |
PDB Entry: 1ngg (more details), 2.19 Å
SCOPe Domain Sequences for d1ngga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngga2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea vaygaavqaails
Timeline for d1ngga2: