Lineage for d5gjab_ (5gja B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2424882Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2424883Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins)
    common fold is rather distorted
  6. 2424960Protein automated matches [190217] (4 species)
    not a true protein
  7. 2424978Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [186990] (3 PDB entries)
  8. 2424981Domain d5gjab_: 5gja B: [334068]
    automated match to d1w9ya1
    complexed with 6pc, zn

Details for d5gjab_

PDB Entry: 5gja (more details), 2.1 Å

PDB Description: crystal structure of arabidopsis thaliana aco2 in complex with 2-pa
PDB Compounds: (B:) 1-aminocyclopropane-1-carboxylate oxidase 2

SCOPe Domain Sequences for d5gjab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gjab_ b.82.2.1 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kfpvvdlsklngeerdqtmalineacenwgffeivnhglphdlmdkiekmtkdhyktcqe
qkfndmlkskgldnletevedvdwestfyvrhlpqsnlndisdvsdeyrtamkdfgkrle
nlaedlldllcenlglekgylkkvfhgtkgptfgtkvsnyppcpkpemikglrahtdagg
iillfqddkvsglqllkdgdwidvpplnhsivinlgdqlevitngkyksvlhrvvtqqeg
nrmsvasfynpgsdaeispatslvekdseypsfvfddymklyagvkfqpkeprfaamk

SCOPe Domain Coordinates for d5gjab_:

Click to download the PDB-style file with coordinates for d5gjab_.
(The format of our PDB-style files is described here.)

Timeline for d5gjab_: