Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins) common fold is rather distorted |
Protein automated matches [190217] (4 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [186990] (3 PDB entries) |
Domain d5gjab_: 5gja B: [334068] automated match to d1w9ya1 complexed with 6pc, zn |
PDB Entry: 5gja (more details), 2.1 Å
SCOPe Domain Sequences for d5gjab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gjab_ b.82.2.1 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kfpvvdlsklngeerdqtmalineacenwgffeivnhglphdlmdkiekmtkdhyktcqe qkfndmlkskgldnletevedvdwestfyvrhlpqsnlndisdvsdeyrtamkdfgkrle nlaedlldllcenlglekgylkkvfhgtkgptfgtkvsnyppcpkpemikglrahtdagg iillfqddkvsglqllkdgdwidvpplnhsivinlgdqlevitngkyksvlhrvvtqqeg nrmsvasfynpgsdaeispatslvekdseypsfvfddymklyagvkfqpkeprfaamk
Timeline for d5gjab_: