Lineage for d1b43a2 (1b43 A:1-219)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71718Fold c.53: Resolvase-like [53040] (2 superfamilies)
  4. 71719Superfamily c.53.1: Resolvase-like [53041] (2 families) (S)
  5. 71730Family c.53.1.2: 5' to 3' exonuclease [53045] (5 proteins)
  6. 71737Protein Fen-1 nuclease [53054] (1 species)
  7. 71738Species Archaeon Pyrococcus furiosus [TaxId:2261] [53055] (1 PDB entry)
  8. 71739Domain d1b43a2: 1b43 A:1-219 [33362]
    Other proteins in same PDB: d1b43a1, d1b43b1

Details for d1b43a2

PDB Entry: 1b43 (more details), 2 Å

PDB Description: fen-1 from p. furiosus

SCOP Domain Sequences for d1b43a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b43a2 c.53.1.2 (A:1-219) Fen-1 nuclease {Archaeon Pyrococcus furiosus}
gvpigeiiprkeielenlygkkiaidalnaiyqflstirqkdgtplmdskgritshlsgl
fyrtinlmeagikpvyvfdgeppefkkkelekrreareeaeekwrealekgeieearkya
qratrvnemliedakkllelmgipivqapsegeaqaaymaakgsvyasasqdydsllfga
prlvrnltitgkrklpgknvyveikpeliileevlkelk

SCOP Domain Coordinates for d1b43a2:

Click to download the PDB-style file with coordinates for d1b43a2.
(The format of our PDB-style files is described here.)

Timeline for d1b43a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b43a1