Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
Protein automated matches [190223] (5 species) not a true protein |
Species Diaphorobacter sp. [TaxId:1302548] [319967] (1 PDB entry) |
Domain d5xbpf_: 5xbp F: [333356] Other proteins in same PDB: d5xbpa1, d5xbpa2, d5xbpd1, d5xbpd2, d5xbpg1, d5xbpg2 automated match to d2bmob1 complexed with fe, fes |
PDB Entry: 5xbp (more details), 2.9 Å
SCOPe Domain Sequences for d5xbpf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xbpf_ d.17.4.4 (F:) automated matches {Diaphorobacter sp. [TaxId: 1302548]} mintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvape ikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfvt nvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdyp erilphnllvfl
Timeline for d5xbpf_: