Lineage for d5xbpf_ (5xbp F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543693Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2543749Protein automated matches [190223] (5 species)
    not a true protein
  7. 2543833Species Diaphorobacter sp. [TaxId:1302548] [319967] (1 PDB entry)
  8. 2543835Domain d5xbpf_: 5xbp F: [333356]
    Other proteins in same PDB: d5xbpa1, d5xbpa2, d5xbpd1, d5xbpd2, d5xbpg1, d5xbpg2
    automated match to d2bmob1
    complexed with fe, fes

Details for d5xbpf_

PDB Entry: 5xbp (more details), 2.9 Å

PDB Description: oxygenase component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2
PDB Compounds: (F:) 3NT oxygenase beta subunit

SCOPe Domain Sequences for d5xbpf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xbpf_ d.17.4.4 (F:) automated matches {Diaphorobacter sp. [TaxId: 1302548]}
mintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvape
ikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfvt
nvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdyp
erilphnllvfl

SCOPe Domain Coordinates for d5xbpf_:

Click to download the PDB-style file with coordinates for d5xbpf_.
(The format of our PDB-style files is described here.)

Timeline for d5xbpf_: