Lineage for d5jaxa_ (5jax A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2426017Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2426259Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2426260Protein automated matches [226927] (18 species)
    not a true protein
  7. 2426288Species Human (Homo sapiens) [TaxId:9606] [256346] (16 PDB entries)
  8. 2426291Domain d5jaxa_: 5jax A: [333270]
    automated match to d4ku7a_
    complexed with 6j7, ca, na

Details for d5jaxa_

PDB Entry: 5jax (more details), 1.49 Å

PDB Description: pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-br-cgmp
PDB Compounds: (A:) cGMP-dependent protein kinase 1

SCOPe Domain Sequences for d5jaxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jaxa_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiiskgtv
nvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhlig
glddvsnkay

SCOPe Domain Coordinates for d5jaxa_:

Click to download the PDB-style file with coordinates for d5jaxa_.
(The format of our PDB-style files is described here.)

Timeline for d5jaxa_: