Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein automated matches [190545] (9 species) not a true protein |
Species Alcaligenes faecalis [TaxId:511] [187784] (4 PDB entries) |
Domain d5x31a1: 5x31 A:1-123 [333077] Other proteins in same PDB: d5x31a2, d5x31b2 automated match to d8paza_ complexed with cu |
PDB Entry: 5x31 (more details), 2.6 Å
SCOPe Domain Sequences for d5x31a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x31a1 b.6.1.1 (A:1-123) automated matches {Alcaligenes faecalis [TaxId: 511]} enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia sak
Timeline for d5x31a1: