SCOPe 2.07: Domain d5x31a1: 5x31 A:1-123

Lineage for d5x31a1 (5x31 A:1-123)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein automated matches [190545] (9 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [187784] (4 PDB entries)

8. Domain d5x31a1: 5x31 A:1-123 [333077]
   Other proteins in same PDB: d5x31a2, d5x31b2
   automated match to d8paza_
   complexed with cu

Details for d5x31a1

PDB Entry: 5x31, 2.6 Å

PDB Description: pseudoazurin from alcaligenes faecalis (space group p65)

PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d5x31a1:

Sequence; same for both SEQRES and ATOM records:

>d5x31a1 b.6.1.1 (A:1-123) automated matches {Alcaligenes faecalis [TaxId: 511]}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
sak

Timeline for d5x31a1:

• d5x31a1 first appeared in SCOPe 2.06
  
• d5x31a1 appears in the current release, SCOPe 2.08