SCOPe 2.07: Domain d5v9ha1: 5v9h A:7-259

Lineage for d5v9ha1 (5v9h A:7-259)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)

6. Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (42 PDB entries)

8. Domain d5v9ha1: 5v9h A:7-259 [333049]
   Other proteins in same PDB: d5v9ha2, d5v9hb2
   automated match to d3dt2a1
   complexed with 1pe, gdp, mn, na, pga

Details for d5v9ha1

PDB Entry: 5v9h, 2.15 Å

PDB Description: structure of the h477r variant of rat cytosolic pepck in complex with phosphoglycolate and gdp.

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d5v9ha1:

Sequence; same for both SEQRES and ATOM records:

>d5v9ha1 c.109.1.1 (A:7-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqeegvi
rklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedfekaf
narfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvlealgd
gefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllgkkcf
alriasrlakeeg

Timeline for d5v9ha1:

• d5v9ha1 first appeared in SCOPe 2.06
  
• d5v9ha1 appears in the current release, SCOPe 2.08