Lineage for d5j5nb1 (5j5n B:3-84)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2488434Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [186776] (11 PDB entries)
  8. 2488449Domain d5j5nb1: 5j5n B:3-84 [332896]
    Other proteins in same PDB: d5j5na2, d5j5nb2
    automated match to d5agya1
    complexed with gsh; mutant

Details for d5j5nb1

PDB Entry: 5j5n (more details), 2.63 Å

PDB Description: crystal structure of the r39w mutant of populus trichocarpa glutathione transferase ptgstu30 in complex with glutathione
PDB Compounds: (B:) Glutathione transferase family protein

SCOPe Domain Sequences for d5j5nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j5nb1 c.47.1.0 (B:3-84) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
sdqvtlldfwpspfgmrvrlalaekgvkyeyseedlwnksalllqmnpvnkqipvlvhng
kpvcesliivqyidevwkdsap

SCOPe Domain Coordinates for d5j5nb1:

Click to download the PDB-style file with coordinates for d5j5nb1.
(The format of our PDB-style files is described here.)

Timeline for d5j5nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j5nb2