SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jwrb_ (5jwr B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118848Family c.47.1.15: KaiB-like [102449] (3 protein domains)
    Pfam PF07689; contains members with alternative folds
  6. 2118862Protein automated matches [190797] (3 species)
    not a true protein
  7. 2118875Species Thermosynechococcus elongatus [TaxId:197221] [188059] (5 PDB entries)
  8. 2289096Domain d5jwrb_: 5jwr B: [332397]
    automated match to d2qkeb_
    complexed with po4

Details for d5jwrb_

PDB Entry: 5jwr (more details), 2.61 Å

PDB Description: crystal structure of foldswitch-stabilized kaib in complex with the n- terminal ci domain of kaic and a dimer of kaia c-terminal domains from thermosynechococcus elongatus
PDB Compounds: (B:) Circadian clock protein kaiB

SCOPe Domain Sequences for d5jwrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jwrb_ c.47.1.15 (B:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ktavlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkilatptl
akvlpppvrriigdlsnrekvlialrlla

SCOPe Domain Coordinates for d5jwrb_:

Click to download the PDB-style file with coordinates for d5jwrb_.
(The format of our PDB-style files is described here.)

Timeline for d5jwrb_:

  • d5jwrb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30