SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h2fo_ (5h2f O:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2224301Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2224302Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2224344Family f.4.1.4: PsbO-like [161115] (2 protein domains)
    Pfam PF01716; MSP
  6. 2224345Protein Manganese-stabilising protein, PsbO [161116] (2 species)
  7. 2224348Species Thermosynechococcus vulcanus [TaxId:32053] [189919] (10 PDB entries)
  8. 2289019Domain d5h2fo_: 5h2f O: [332320]
    Other proteins in same PDB: d5h2fu_
    automated match to d4il6o_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fo_

PDB Entry: 5h2f (more details), 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d5h2fo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2fo_ f.4.1.4 (O:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
epa

SCOPe Domain Coordinates for d5h2fo_:

Click to download the PDB-style file with coordinates for d5h2fo_.
(The format of our PDB-style files is described here.)

Timeline for d5h2fo_:

  • d5h2fo_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-24