Lineage for d5wq0a_ (5wq0 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464320Species Paenisporosarcina sp. [TaxId:1231057] [332209] (2 PDB entries)
  8. 2464322Domain d5wq0a_: 5wq0 A: [332295]
    automated match to d2mska_
    complexed with mg

Details for d5wq0a_

PDB Entry: 5wq0 (more details), 2.6 Å

PDB Description: receiver domain of spo0a from paenisporosarcina sp. tg-14
PDB Compounds: (A:) Stage 0 sporulation protein

SCOPe Domain Sequences for d5wq0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wq0a_ c.23.1.0 (A:) automated matches {Paenisporosarcina sp. [TaxId: 1231057]}
kikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllldiimphl
dglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrlvnqilqv
agh

SCOPe Domain Coordinates for d5wq0a_:

Click to download the PDB-style file with coordinates for d5wq0a_.
(The format of our PDB-style files is described here.)

Timeline for d5wq0a_: