Lineage for d5b3sa1 (5b3s A:2-514)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2227563Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2227564Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2227565Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 protein domains)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2227617Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 2227618Species Cow (Bos taurus) [TaxId:9913] [81432] (20 PDB entries)
  8. 2288707Domain d5b3sa1: 5b3s A:2-514 [332008]
    Other proteins in same PDB: d5b3sa2, d5b3sb1, d5b3sb2, d5b3sb3, d5b3sc_, d5b3sd_, d5b3se_, d5b3sf_, d5b3sg_, d5b3sh_, d5b3si1, d5b3si2, d5b3sj_, d5b3sk_, d5b3sl_, d5b3sm_, d5b3sn2, d5b3so1, d5b3so2, d5b3so3, d5b3sp_, d5b3sq_, d5b3sr_, d5b3ss_, d5b3st_, d5b3su_, d5b3sv1, d5b3sv2, d5b3sw_, d5b3sx_, d5b3sy_, d5b3sz_
    automated match to d1v54a_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5b3sa1

PDB Entry: 5b3s (more details), 1.68 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed- valence state at 1.68 angstrom resolution (50 k)
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d5b3sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b3sa1 f.24.1.1 (A:2-514) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
finrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvtah
afvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmveag
agtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyqt
plfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffghp
evyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvdt
rayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlans
sldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvgv
nmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskre
vltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d5b3sa1:

Click to download the PDB-style file with coordinates for d5b3sa1.
(The format of our PDB-style files is described here.)

Timeline for d5b3sa1:

  • d5b3sa1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23