SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b3sd_ (5b3s D:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2226298Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
    automatically mapped to Pfam PF02936
  5. 2226299Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 protein domains)
  6. 2226300Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2226301Species Cow (Bos taurus) [TaxId:9913] [81403] (14 PDB entries)
  8. 2288307Domain d5b3sd_: 5b3s D: [331608]
    Other proteins in same PDB: d5b3sa1, d5b3sa2, d5b3sb1, d5b3sb2, d5b3sb3, d5b3sc_, d5b3se_, d5b3sf_, d5b3sg_, d5b3sh_, d5b3si1, d5b3si2, d5b3sj_, d5b3sk_, d5b3sl_, d5b3sm_, d5b3sn1, d5b3sn2, d5b3so1, d5b3so2, d5b3so3, d5b3sp_, d5b3sr_, d5b3ss_, d5b3st_, d5b3su_, d5b3sv1, d5b3sv2, d5b3sw_, d5b3sx_, d5b3sy_, d5b3sz_
    automated match to d1v54d_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5b3sd_

PDB Entry: 5b3s (more details), 1.68 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed- valence state at 1.68 angstrom resolution (50 k)
PDB Compounds: (D:) cytochrome c oxidase subunit 4 isoform 1, mitochondrial

SCOPe Domain Sequences for d5b3sd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b3sd_ f.23.1.1 (D:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOPe Domain Coordinates for d5b3sd_:

Click to download the PDB-style file with coordinates for d5b3sd_.
(The format of our PDB-style files is described here.)

Timeline for d5b3sd_:

  • d5b3sd_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23