![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) ![]() automatically mapped to Pfam PF00737 |
![]() | Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
![]() | Protein Photosystem II reaction center protein H, PsbH [161027] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries) |
![]() | Domain d5ws5h_: 5ws5 H: [331578] Other proteins in same PDB: d5ws5a_, d5ws5b_, d5ws5c_, d5ws5d_, d5ws5e_, d5ws5f_, d5ws5i_, d5ws5j_, d5ws5k_, d5ws5l_, d5ws5m1, d5ws5m2, d5ws5o_, d5ws5t_, d5ws5u_, d5ws5v_, d5ws5x_, d5ws5z_ automated match to d2axth1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 5ws5 (more details), 2.35 Å
SCOPe Domain Sequences for d5ws5h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ws5h_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]} arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs wkal
Timeline for d5ws5h_: