SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ws5j_ (5ws5 j:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227352Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) (S)
    automatically mapped to Pfam PF01788
  5. 2227353Family f.23.32.1: PsbJ-like [161022] (2 protein domains)
    Pfam PF01788
  6. 2227362Protein automated matches [191002] (3 species)
    not a true protein
  7. 2227366Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (8 PDB entries)
  8. 2288276Domain d5ws5j_: 5ws5 j: [331577]
    Other proteins in same PDB: d5ws5a_, d5ws5b_, d5ws5c_, d5ws5e_, d5ws5f_, d5ws5h_, d5ws5k_, d5ws5o_, d5ws5v_, d5ws5x_, d5ws5z_
    automated match to d5b5ej_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5ws5j_

PDB Entry: 5ws5 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash dark dataset)
PDB Compounds: (j:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5ws5j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws5j_ f.23.32.1 (j:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mseggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d5ws5j_:

Click to download the PDB-style file with coordinates for d5ws5j_.
(The format of our PDB-style files is described here.)

Timeline for d5ws5j_:

  • d5ws5j_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-17