SCOPe 2.07: Domain d5uatd2: 5uat D:165-273

Lineage for d5uatd2 (5uat D:165-273)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)

8. Domain d5uatd2: 5uat D:165-273 [331561]
   Other proteins in same PDB: d5uata1, d5uatb1, d5uatb3, d5uatc1, d5uatc3, d5uatd1, d5uatd3, d5uate1, d5uate3
   automated match to d2izzc2
   complexed with ndp, peg, so4

Details for d5uatd2

PDB Entry: 5uat, 1.92 Å

PDB Description: structure of human pycr-1 complexed with nadph

PDB Compounds: (D:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d5uatd2:

Sequence; same for both SEQRES and ATOM records:

>d5uatd2 a.100.1.0 (D:165-273) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmad

Timeline for d5uatd2:

• d5uatd2 first appeared in SCOPe 2.06
  
• d5uatd2 appears in the current release, SCOPe 2.08