Lineage for d5uawb2 (5uaw B:165-275)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2334748Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)
  8. 2334787Domain d5uawb2: 5uaw B:165-275 [331546]
    Other proteins in same PDB: d5uawa1, d5uawb1, d5uawb3, d5uawc1, d5uawd1, d5uawd3, d5uawe1, d5uawe3
    automated match to d2izzc2
    complexed with so4

Details for d5uawb2

PDB Entry: 5uaw (more details), 1.85 Å

PDB Description: structure of apo human pycr-1 crystallized in space group p21212
PDB Compounds: (B:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d5uawb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uawb2 a.100.1.0 (B:165-275) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqe

SCOPe Domain Coordinates for d5uawb2:

Click to download the PDB-style file with coordinates for d5uawb2.
(The format of our PDB-style files is described here.)

Timeline for d5uawb2: