Lineage for d5v0zc_ (5v0z C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423278Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2423279Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2423626Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2423627Protein automated matches [190967] (35 species)
    not a true protein
  7. 2423821Species Staphylococcus aureus [TaxId:93062] [225621] (4 PDB entries)
  8. 2423824Domain d5v0zc_: 5v0z C: [331449]
    automated match to d3ftta_
    complexed with cl, coa, edo, po4, unx

Details for d5v0zc_

PDB Entry: 5v0z (more details), 1.26 Å

PDB Description: crystal structure of galactoside o-acetyltransferase complex with coa (p32 space group).
PDB Compounds: (C:) Putative acetyltransferase SACOL2570

SCOPe Domain Sequences for d5v0zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v0zc_ b.81.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn
vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh
rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv
vrkidndlp

SCOPe Domain Coordinates for d5v0zc_:

Click to download the PDB-style file with coordinates for d5v0zc_.
(The format of our PDB-style files is described here.)

Timeline for d5v0zc_: