SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5pida_ (5pid A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071116Family b.82.2.14: Histone demethylase core [254153] (4 protein domains)
    Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
  6. 2071178Protein automated matches [254635] (1 species)
    not a true protein
  7. 2071179Species Human (Homo sapiens) [TaxId:9606] [255633] (263 PDB entries)
  8. 2287884Domain d5pida_: 5pid A: [331185]
    automated match to d3dxua_
    complexed with edo, mg, ni, oga, so4, zn

Details for d5pida_

PDB Entry: 5pid (more details), 1.5 Å

PDB Description: pandda analysis group deposition -- crystal structure of jmjd2d after initial refinement with no ligand modelled (structure 26)
PDB Compounds: (A:) Lysine-specific demethylase 4D

SCOPe Domain Sequences for d5pida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5pida_ b.82.2.14 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
scgearvtfsmdafvrilqperydlwkrgqd

SCOPe Domain Coordinates for d5pida_:

Click to download the PDB-style file with coordinates for d5pida_.
(The format of our PDB-style files is described here.)

Timeline for d5pida_:

  • d5pida_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16