SCOPe 2.07: Domain d5jhba2: 5jhb A:525-725

Lineage for d5jhba2 (5jhb A:525-725)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (27 families)

5. Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
   automatically mapped to Pfam PF00613
   this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain

6. Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries)

8. Domain d5jhba2: 5jhb A:525-725 [331072]
   Other proteins in same PDB: d5jhba1, d5jhba3, d5jhba4
   automated match to d1e8ya1
   complexed with 6k5, so4

Details for d5jhba2

PDB Entry: 5jhb, 2.48 Å

PDB Description: structure of phosphoinositide 3-kinase gamma (pi3k) bound to the potent inhibitor pikin3

PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d5jhba2:

Sequence, based on SEQRES records:

>d5jhba2 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records):

>d5jhba2 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpiaaempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgq
qeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyl
lqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileay
lrgcg

Timeline for d5jhba2:

• d5jhba2 first appeared in SCOPe 2.06
  
• d5jhba2 appears in the current release, SCOPe 2.08