Lineage for d5ibya2 (5iby A:248-334)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613577Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 2613578Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 2613662Family d.224.1.0: automated matches [191547] (1 protein)
    not a true family
  6. 2613663Protein automated matches [190942] (7 species)
    not a true protein
  7. 2613674Species Enterococcus faecalis [TaxId:226185] [330981] (5 PDB entries)
  8. 2613678Domain d5ibya2: 5iby A:248-334 [331025]
    Other proteins in same PDB: d5ibya1, d5ibya3
    automated match to d1vqza1
    complexed with lpa

Details for d5ibya2

PDB Entry: 5iby (more details), 1.85 Å

PDB Description: crystal structure of enterococcus faecalis lipoate-protein ligase a (lpla-2) in complex with lipoic acid
PDB Compounds: (A:) Lipoate--protein ligase

SCOPe Domain Sequences for d5ibya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ibya2 d.224.1.0 (A:248-334) automated matches {Enterococcus faecalis [TaxId: 226185]}
kspafnlerrhrfpigsiemkmnvadgaiqeikifgdffglgeikdvediltgvkydkas
leeaidqidvkkyfgniekedllgliy

SCOPe Domain Coordinates for d5ibya2:

Click to download the PDB-style file with coordinates for d5ibya2.
(The format of our PDB-style files is described here.)

Timeline for d5ibya2: