SCOPe 2.08: Domain d1ngsa3: 1ngs A:535-680

Lineage for d1ngsa3 (1ngs A:535-680)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)

6. Protein Transketolase (TK), C-domain [52924] (4 species)
   two N-terminal domains are PP and Pyr modules of thiamin-binding fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)

8. Domain d1ngsa3: 1ngs A:535-680 [33098]
   Other proteins in same PDB: d1ngsa1, d1ngsa2, d1ngsb1, d1ngsb2
   complexed with ca, e4p, tpp

Details for d1ngsa3

PDB Entry: 1ngs, 2.4 Å

PDB Description: complex of transketolase with thiamin diphosphate, ca2+ and acceptor substrate erythrose-4-phosphate

PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d1ngsa3:

Sequence; same for both SEQRES and ATOM records:

>d1ngsa3 c.48.1.1 (A:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

Timeline for d1ngsa3:

• d1ngsa3 first appeared (with stable ids) in SCOP 1.55
  
• d1ngsa3 appears in SCOPe 2.07