Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (158 species) not a true protein |
Species Vibrio vulnificus [TaxId:672] [330964] (5 PDB entries) |
Domain d5b7da1: 5b7d A:86-301 [330969] Other proteins in same PDB: d5b7da2, d5b7db2 automated match to d1i6aa_ complexed with so4; mutant |
PDB Entry: 5b7d (more details), 1.52 Å
SCOPe Domain Sequences for d5b7da1:
Sequence, based on SEQRES records: (download)
>d5b7da1 c.94.1.0 (A:86-301) automated matches {Vibrio vulnificus [TaxId: 672]} elgslcqgdsmqgqlklgciptiapfllcdlvqeinqrfpqlnlllredtttnlltalrh geldvlilalpveidgmesrvvgqdpfkmvisrhqagaikvpikyddlpdesvfllekgh cltehavsackltdkekinpfsatslhtlvqmvanglgttfipqmaidhglldnqnlvvi eppgqqayrdiglvwrpsssrsktfnqlaevvsell
>d5b7da1 c.94.1.0 (A:86-301) automated matches {Vibrio vulnificus [TaxId: 672]} elsmqgqlklgciptiapfllcdlvqeinqrfpqlnlllredtttnlltalrhgeldvli lalpveidgmesrvvgqdpfkmvisrhqagaikvpikyddlpdesvfllekghcltehav sackltdkekinpfsatslhtlvqmvanglgttfipqmaidhglldnqnlvvieppgqqa yrdiglvwrpsssrsktfnqlaevvsell
Timeline for d5b7da1: