Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) [52906] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [52908] (1 PDB entry) |
Domain d1qmve_: 1qmv E: [33070] |
PDB Entry: 1qmv (more details), 1.7 Å
SCOPe Domain Sequences for d1qmve_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qmve_ c.47.1.10 (E:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} asgnarigkpapdfkatavvdgafkevklsdykgkyvvlffypldftfvcpteiiafsnr aedfrklgcevlgvsvdsqfthlawintprkegglgplniplladvtrrlsedygvlktd egiayrglfiidgkgvlrqitvndlpvgrsvdealrlvqafqytdehgevcpagwkpgsd tikpnvddskeyfskhn
Timeline for d1qmve_: