Lineage for d5sxpd_ (5sxp D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392869Protein automated matches [190043] (8 species)
    not a true protein
  7. 2392904Species Human (Homo sapiens) [TaxId:9606] [187799] (39 PDB entries)
  8. 2392941Domain d5sxpd_: 5sxp D: [330432]
    automated match to d2ak5a_

Details for d5sxpd_

PDB Entry: 5sxp (more details), 1.65 Å

PDB Description: structural basis for the interaction between itch prr and beta-pix
PDB Compounds: (D:) Rho guanine nucleotide exchange factor 7

SCOPe Domain Sequences for d5sxpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sxpd_ b.34.2.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nnqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegtlngrtgwfpsnyvrevka

SCOPe Domain Coordinates for d5sxpd_:

Click to download the PDB-style file with coordinates for d5sxpd_.
(The format of our PDB-style files is described here.)

Timeline for d5sxpd_: