Lineage for d1b8xa2 (1b8x A:1-80)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368661Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1368820Protein Class beta GST [81368] (4 species)
  7. 1368821Species Escherichia coli [TaxId:562] [52883] (3 PDB entries)
  8. 1368826Domain d1b8xa2: 1b8x A:1-80 [33033]
    Other proteins in same PDB: d1b8xa1

Details for d1b8xa2

PDB Entry: 1b8x (more details), 2.7 Å

PDB Description: glutathione s-transferase fused with the nuclear matrix targeting signal of the transcription factor aml-1
PDB Compounds: (A:) protein (aml-1b)

SCOPe Domain Sequences for d1b8xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8xa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]}
spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
dvkltqsmaiiryiadkhnm

SCOPe Domain Coordinates for d1b8xa2:

Click to download the PDB-style file with coordinates for d1b8xa2.
(The format of our PDB-style files is described here.)

Timeline for d1b8xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b8xa1