Lineage for d5b66l_ (5b66 L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026391Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 3026392Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 3026393Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)
  7. 3026401Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries)
  8. 3026402Domain d5b66l_: 5b66 L: [330316]
    Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66d_, d5b66e_, d5b66f_, d5b66h_, d5b66i_, d5b66j_, d5b66k_, d5b66m_, d5b66o_, d5b66t_, d5b66u_, d5b66v_, d5b66x_, d5b66z_
    automated match to d2axtl1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66l_

PDB Entry: 5b66 (more details), 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d5b66l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b66l_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d5b66l_:

Click to download the PDB-style file with coordinates for d5b66l_.
(The format of our PDB-style files is described here.)

Timeline for d5b66l_: