SCOPe 2.07: Domain d5b66l_: 5b66 L:

Lineage for d5b66l_ (5b66 L:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 protein domains)
   Pfam PF02419

6. Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (13 PDB entries)

8. Domain d5b66l_: 5b66 L: [330316]
   Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66d_, d5b66e_, d5b66f_, d5b66h_, d5b66i_, d5b66j_, d5b66k_, d5b66m_, d5b66o_, d5b66t_, d5b66u_, d5b66v_, d5b66x_, d5b66z_
   automated match to d2axtl1
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66l_

PDB Entry: 5b66, 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex

PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d5b66l_:

Sequence; same for both SEQRES and ATOM records:

>d5b66l_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d5b66l_:

• d5b66l_ first appeared in SCOPe 2.06