Lineage for d5b66f_ (5b66 F:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2579375Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2579376Family f.23.38.1: Cytochrome b559 subunits [161046] (3 protein domains)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2579404Protein automated matches [191000] (4 species)
    not a true protein
  7. 2579422Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (9 PDB entries)
  8. 2579424Domain d5b66f_: 5b66 F: [330315]
    Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66d_, d5b66e_, d5b66h_, d5b66i_, d5b66j_, d5b66k_, d5b66l_, d5b66m_, d5b66o_, d5b66t_, d5b66u_, d5b66v_, d5b66x_, d5b66z_
    automated match to d2axtf1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66f_

PDB Entry: 5b66 (more details), 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5b66f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b66f_ f.23.38.1 (F:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
ypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d5b66f_:

Click to download the PDB-style file with coordinates for d5b66f_.
(The format of our PDB-style files is described here.)

Timeline for d5b66f_: